Lineage for d1adg_2 (1adg 175-324)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) 
Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins) Protein Alcohol dehydrogenase [51737] (4 species) Species Horse (Equus caballus) [TaxId:9796] [51738] (22 PDB entries) 
Domain d1adg_2: 1adg 175-324 [29716]
Other proteins in same PDB: d1adg_1
Details for d1adg_2
PDB Entry: 1adg (more details), 2.7 Å
PDB Description: crystallographic studies of two alcohol dehydrogenase-bound analogs of thiazole-4-carboxamide adenine dinucleotide (tad), the active anabolite of the antitumor agent tiazofurin
SCOP Domain Sequences for d1adg_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adg_2 c.2.1.1 (175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakake
vgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgv
ppdsqnlsmnpmlllsgrtwkgaifggfks
SCOP Domain Coordinates for d1adg_2:
Click to download the PDB-style file with coordinates for d1adg_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1adg_2:
- d1adg_2 appears in SCOP 1.57
- d1adg_2 appears in the current release, SCOPe 2.08, called d1adga2
View in 3D
