Lineage for d1wkfa_ (1wkf A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 974730Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 974731Family c.1.20.1: tRNA-guanine transglycosylase [51714] (3 proteins)
  6. 974742Protein Queosine tRNA-guanine transglycosylase [51715] (2 species)
    contains zinc-binding subdomain
  7. 974748Species Zymomonas mobilis [TaxId:542] [51716] (51 PDB entries)
    Uniprot P28720
  8. 974796Domain d1wkfa_: 1wkf A: [29662]
    complexed with zn

Details for d1wkfa_

PDB Entry: 1wkf (more details), 2.2 Å

PDB Description: trna-guanine transglycosylase
PDB Compounds: (A:) tRNA-guanine transglycosylase

SCOPe Domain Sequences for d1wkfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkfa_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafyectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

SCOPe Domain Coordinates for d1wkfa_:

Click to download the PDB-style file with coordinates for d1wkfa_.
(The format of our PDB-style files is described here.)

Timeline for d1wkfa_: