SCOPe 2.01: Domain d1f3ea_: 1f3e A:

Lineage for d1f3ea_ (1f3e A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family)

5. Family c.1.20.1: tRNA-guanine transglycosylase [51714] (3 proteins)

6. Protein Queosine tRNA-guanine transglycosylase [51715] (2 species)
   contains zinc-binding subdomain

7. Species Zymomonas mobilis [TaxId:542] [51716] (51 PDB entries)
   Uniprot P28720

8. Domain d1f3ea_: 1f3e A: [29661]
   complexed with dpz, zn

Details for d1f3ea_

PDB Entry: 1f3e, 1.85 Å

PDB Description: a new target for shigellosis: rational design and crystallographic studies of inhibitors of trna-guanine transglycosylase

PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d1f3ea_:

Sequence; same for both SEQRES and ATOM records:

>d1f3ea_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

Timeline for d1f3ea_:

• d1f3ea_ first appeared (with stable ids) in SCOP 1.55
  
• d1f3ea_ appears in SCOP 1.75
  
• d1f3ea_ appears in SCOPe 2.02
  
• d1f3ea_ appears in the current release, SCOPe 2.08