Lineage for d1enua_ (1enu A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1150313Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 1150314Family c.1.20.1: tRNA-guanine transglycosylase [51714] (3 proteins)
  6. 1150325Protein Queosine tRNA-guanine transglycosylase [51715] (2 species)
    contains zinc-binding subdomain
  7. 1150331Species Zymomonas mobilis [TaxId:542] [51716] (51 PDB entries)
    Uniprot P28720
  8. 1150366Domain d1enua_: 1enu A: [29660]
    complexed with apz, zn

Details for d1enua_

PDB Entry: 1enu (more details), 1.95 Å

PDB Description: a new target for shigellosis: rational design and crystallographic studies of inhibitors of trna-guanine transglycosylase
PDB Compounds: (A:) tRNA-guanine transglycosylase

SCOPe Domain Sequences for d1enua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enua_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

SCOPe Domain Coordinates for d1enua_:

Click to download the PDB-style file with coordinates for d1enua_.
(The format of our PDB-style files is described here.)

Timeline for d1enua_: