Lineage for d1efza_ (1efz A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2101822Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2101823Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 2101834Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2101863Species Zymomonas mobilis [TaxId:542] [51716] (113 PDB entries)
    Uniprot P28720
  8. 2101943Domain d1efza_: 1efz A: [29659]
    complexed with prf, zn

Details for d1efza_

PDB Entry: 1efz (more details), 2 Å

PDB Description: mutagenesis and crystallographic studies of zymomonas mobilis trna- guanine transglycosylase to elucidate the role of serine 103 for enzymatic activity
PDB Compounds: (A:) tRNA-guanine transglycosylase

SCOPe Domain Sequences for d1efza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efza_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdaggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

SCOPe Domain Coordinates for d1efza_:

Click to download the PDB-style file with coordinates for d1efza_.
(The format of our PDB-style files is described here.)

Timeline for d1efza_: