SCOP 1.65: Domain d2reqd1: 2req D:17-475

Lineage for d2reqd1 (2req D:17-475)

Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (3 families)
Family c.1.19.1: Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain [51704] (2 proteins)
the subunits are clearly related but only one (alpha) is active
Protein Methylmalonyl-CoA mutase beta subunit, domain 1 [88711] (1 species)
the subunits are clearly related but only one (alpha) is active
Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88712] (8 PDB entries)
Domain d2reqd1: 2req D:17-475 [29643]
Other proteins in same PDB: d2reqa1, d2reqa2, d2reqb2, d2reqc1, d2reqc2, d2reqd2
complexed with b12, coa; mutant

Details for d2reqd1

PDB Entry: 2req (more details), 2.5 Å

PDB Description: methylmalonyl-coa mutase, non-productive coa complex, in open conformation representing substrate-free state

SCOP Domain Sequences for d2reqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2reqd1 c.1.19.1 (D:17-475) Methylmalonyl-CoA mutase beta subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii}
tpttlslagdfpkateeqwerevekvlnrgrppekqltfaeclkrltvhtvdgidivpmy
rpkdapkklgypgvapftrgttvrngdmdawdvralhedpdekftrkaileglergvtsl
llrvdpdaiapehldevlsdvllemtkvevfsrydqgaaaealvsvyersdkpakdlaln
lgldpigfaalqgtepdltvlgdwvrrlakfspdsravtidaniyhnagagdvaelawal
atgaeyvralveqgftateafdtinfrvtathdqfltiarlralreawarigevfgvded
krgarqnaitswreltredpyvnilrgsiatfsasvggaesittlpftqalglpeddfpl
riarntgivlaeevnigrvndpaggsyyvesltrsladaawkefqeveklggmskavmte
hvtkvldacnaerakrlanrkqpitavsefpmigarsie

SCOP Domain Coordinates for d2reqd1:

Click to download the PDB-style file with coordinates for d2reqd1.
(The format of our PDB-style files is described here.)

Timeline for d2reqd1: