Lineage for d1e1cd1 (1e1c D:20-475)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1575689Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 1575690Family c.1.19.1: Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain [51704] (2 proteins)
    the subunits are clearly related but only one (alpha) is active
    automatically mapped to Pfam PF01642
  6. 1575708Protein Methylmalonyl-CoA mutase beta subunit, domain 1 [88711] (1 species)
    the subunits are clearly related but only one (alpha) is active
  7. 1575709Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88712] (8 PDB entries)
  8. 1575721Domain d1e1cd1: 1e1c D:20-475 [29639]
    Other proteins in same PDB: d1e1ca1, d1e1ca2, d1e1cb2, d1e1cc1, d1e1cc2, d1e1cd2
    complexed with b12, dca; mutant

Details for d1e1cd1

PDB Entry: 1e1c (more details), 2.62 Å

PDB Description: methylmalonyl-coa mutase h244a mutant
PDB Compounds: (D:) methylmalonyl-coa mutase beta chain

SCOPe Domain Sequences for d1e1cd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1cd1 c.1.19.1 (D:20-475) Methylmalonyl-CoA mutase beta subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
tlslagdfpkateeqwerevekvlnrgrppekqltfaeclkrltvhtvdgidivpmyrpk
dapkklgypgvapftrgttvrngdmdawdvralhedpdekftrkaileglergvtslllr
vdpdaiapehldevlsdvllemtkvevfsrydqgaaaealvsvyersdkpakdlalnlgl
dpigfaalqgtepdltvlgdwvrrlakfspdsravtidaniyhnagagdvaelawalatg
aeyvralveqgftateafdtinfrvtathdqfltiarlralreawarigevfgvdedkrg
arqnaitswreltredpyvnilrgsiatfsasvggaesittlpftqalglpeddfplria
rntgivlaeevnigrvndpaggsyyvesltrsladaawkefqeveklggmskavmtehvt
kvldacnaerakrlanrkqpitavsefpmigarsie

SCOPe Domain Coordinates for d1e1cd1:

Click to download the PDB-style file with coordinates for d1e1cd1.
(The format of our PDB-style files is described here.)

Timeline for d1e1cd1: