SCOP 1.67: Domain d1qpnb1: 1qpn B:617-785

Lineage for d1qpnb1 (1qpn B:617-785)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51690] (1 family)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.1: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51691] (1 protein)

6. Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries)

8. Domain d1qpnb1: 1qpn B:617-785 [29580]
   Other proteins in same PDB: d1qpna2, d1qpnb2, d1qpnc2, d1qpnd2, d1qpne2, d1qpnf2

Details for d1qpnb1

PDB Entry: 1qpn, 2.6 Å

PDB Description: Quinolinate Phosphoribosyl Transferase from Mycobacterium Tuberculosis in Complex with NCNN

SCOP Domain Sequences for d1qpnb1:

Sequence; same for both SEQRES and ATOM records:

>d1qpnb1 c.1.17.1 (B:617-785) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis}
iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv
aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr
dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm

Timeline for d1qpnb1:

• d1qpnb1 first appeared (with stable ids) in SCOP 1.55
  
• d1qpnb1 appears in SCOP 1.65
  
• d1qpnb1 appears in SCOP 1.69
  
• d1qpnb1 appears in the current release, SCOPe 2.08