SCOPe 2.03: Domain d1qpqc1: 1qpq C:1117-1285

Lineage for d1qpqc1 (1qpq C:1117-1285)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins)

6. Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries)

8. Domain d1qpqc1: 1qpq C:1117-1285 [29569]
   Other proteins in same PDB: d1qpqa2, d1qpqb2, d1qpqc2, d1qpqd2, d1qpqe2, d1qpqf2
   complexed with ntm, so4

Details for d1qpqc1

PDB Entry: 1qpq, 2.45 Å

PDB Description: Structure of Quinolinic Acid Phosphoribosyltransferase from Mycobacterium Tuberculosis: A Potential TB Drug Target

PDB Compounds: (C:) quinolinate phosphoribosyltransferase

SCOPe Domain Sequences for d1qpqc1:

Sequence; same for both SEQRES and ATOM records:

>d1qpqc1 c.1.17.1 (C:1117-1285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv
aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr
dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm

Timeline for d1qpqc1:

• d1qpqc1 first appeared (with stable ids) in SCOP 1.55
  
• d1qpqc1 appears in SCOPe 2.02
  
• d1qpqc1 appears in SCOPe 2.04
  
• d1qpqc1 appears in the current release, SCOPe 2.08