Lineage for d1qpqc1 (1qpq C:1117-1285)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839614Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2839615Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins)
  6. 2839634Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species)
  7. 2839635Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries)
  8. 2839644Domain d1qpqc1: 1qpq C:1117-1285 [29569]
    Other proteins in same PDB: d1qpqa2, d1qpqb2, d1qpqc2, d1qpqd2, d1qpqe2, d1qpqf2
    complexed with ntm, so4

Details for d1qpqc1

PDB Entry: 1qpq (more details), 2.45 Å

PDB Description: Structure of Quinolinic Acid Phosphoribosyltransferase from Mycobacterium Tuberculosis: A Potential TB Drug Target
PDB Compounds: (C:) quinolinate phosphoribosyltransferase

SCOPe Domain Sequences for d1qpqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpqc1 c.1.17.1 (C:1117-1285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv
aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr
dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm

SCOPe Domain Coordinates for d1qpqc1:

Click to download the PDB-style file with coordinates for d1qpqc1.
(The format of our PDB-style files is described here.)

Timeline for d1qpqc1: