Lineage for d1qpof1 (1qpo F:2617-2785)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 237993Superfamily c.1.17: Quinolinic acid phosphoribosyltransferase, C-terminal domain [51690] (1 family) (S)
    imcomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 237994Family c.1.17.1: Quinolinic acid phosphoribosyltransferase, C-terminal domain [51691] (1 protein)
  6. 237995Protein Quinolinic acid phosphoribosyltransferase, C-terminal domain [51692] (2 species)
  7. 237996Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries)
  8. 238002Domain d1qpof1: 1qpo F:2617-2785 [29566]
    Other proteins in same PDB: d1qpoa2, d1qpob2, d1qpoc2, d1qpod2, d1qpoe2, d1qpof2
    complexed with so4

Details for d1qpof1

PDB Entry: 1qpo (more details), 2.4 Å

PDB Description: Quinolinate Phosphoribosyl Transferase (QAPRTase) Apo-Enzyme from Mycobacterium Tuberculosis

SCOP Domain Sequences for d1qpof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpof1 c.1.17.1 (F:2617-2785) Quinolinic acid phosphoribosyltransferase, C-terminal domain {Mycobacterium tuberculosis}
iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv
aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr
dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm

SCOP Domain Coordinates for d1qpof1:

Click to download the PDB-style file with coordinates for d1qpof1.
(The format of our PDB-style files is described here.)

Timeline for d1qpof1: