Lineage for d1ximc_ (1xim C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1575074Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1575125Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 1575126Protein D-xylose isomerase [51666] (13 species)
  7. 1575127Species Actinoplanes missouriensis [TaxId:1866] [51673] (14 PDB entries)
  8. 1575130Domain d1ximc_: 1xim C: [29475]
    complexed with co, xyl

Details for d1ximc_

PDB Entry: 1xim (more details), 2.2 Å

PDB Description: arginine residues as stabilizing elements in proteins
PDB Compounds: (C:) d-xylose isomerase

SCOPe Domain Sequences for d1ximc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ximc_ c.1.15.3 (C:) D-xylose isomerase {Actinoplanes missouriensis [TaxId: 1866]}
vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
kpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkklf
hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
afedydadavgakgfgfvklnqlaiehllgar

SCOPe Domain Coordinates for d1ximc_:

Click to download the PDB-style file with coordinates for d1ximc_.
(The format of our PDB-style files is described here.)

Timeline for d1ximc_: