Lineage for d1xid__ (1xid -)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.15: Xylose isomerase-like [51658] (3 families) 
Family c.1.15.3: Xylose isomerase [51665] (1 protein) Protein D-xylose isomerase [51666] (12 species) Species Streptomyces rubiginosus [TaxId:1929] [51670] (15 PDB entries) 
Domain d1xid__: 1xid - [29431]
Details for d1xid__
PDB Entry: 1xid (more details), 1.7 Å
PDB Description: modes of binding substrates and their analogues to the enzyme d-xylose isomerase
SCOP Domain Sequences for d1xid__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xid__ c.1.15.3 (-) D-xylose isomerase {Streptomyces rubiginosus}
mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvqrlaelgahgvtfhdddlip
fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
dvdaaaargmaferldqlamdhllgar
SCOP Domain Coordinates for d1xid__:
Click to download the PDB-style file with coordinates for d1xid__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xid__:
- d1xid__ first appeared (with stable ids) in SCOP 1.55
- d1xid__ appears in SCOP 1.57
- d1xid__ appears in SCOP 1.61
- d1xid__ appears in the current release, SCOPe 2.08, called d1xida_
View in 3D