Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) |
Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins) forms a swapped dimer |
Protein Isocitrate lyase [51642] (5 species) elaborated with additional subdomains |
Species Mycobacterium tuberculosis [TaxId:1773] [51644] (3 PDB entries) |
Domain d1f61a_: 1f61 A: [29319] complexed with mg has additional subdomain(s) that are not in the common domain |
PDB Entry: 1f61 (more details), 2 Å
SCOPe Domain Sequences for d1f61a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} asvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttal
Timeline for d1f61a_: