Lineage for d3enla1 (3enl A:142-436)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1148962Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1148963Family c.1.11.1: Enolase [51605] (1 protein)
  6. 1148964Protein Enolase [51606] (8 species)
    Fold of this protein slightly differs from common fold in topology
  7. 1148965Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (16 PDB entries)
  8. 1148987Domain d3enla1: 3enl A:142-436 [29211]
    Other proteins in same PDB: d3enla2
    complexed with so4

Details for d3enla1

PDB Entry: 3enl (more details), 2.25 Å

PDB Description: refined structure of yeast apo-enolase at 2.25 angstroms resolution
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d3enla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3enla1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

SCOPe Domain Coordinates for d3enla1:

Click to download the PDB-style file with coordinates for d3enla1.
(The format of our PDB-style files is described here.)

Timeline for d3enla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3enla2