Lineage for d4enla1 (4enl A:142-436)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2098970Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2098971Protein Enolase [51606] (10 species)
    Fold of this protein slightly differs from common fold in topology
  7. 2098972Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (16 PDB entries)
  8. 2098979Domain d4enla1: 4enl A:142-436 [29202]
    Other proteins in same PDB: d4enla2
    complexed with so4, zn

Details for d4enla1

PDB Entry: 4enl (more details), 1.9 Å

PDB Description: crystal structure of holoenzyme refined at 1.9 angstroms resolution: trigonal-bipyramidal geometry of the cation binding site
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d4enla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4enla1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

SCOPe Domain Coordinates for d4enla1:

Click to download the PDB-style file with coordinates for d4enla1.
(The format of our PDB-style files is described here.)

Timeline for d4enla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4enla2