Lineage for d3e90a_ (3e90 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643668Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 2643669Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 2643670Family g.96.1.1: Flavivirus non-structural protein NS2B-like [310635] (2 proteins)
  6. 2643676Protein automated matches [310851] (1 species)
    not a true protein
  7. 2643677Species West Nile virus [TaxId:11082] [311209] (3 PDB entries)
  8. 2643679Domain d3e90a_: 3e90 A: [291776]
    Other proteins in same PDB: d3e90b_, d3e90d_
    automated match to d2fp7a_
    protein/RNA complex; complexed with nkk

Details for d3e90a_

PDB Entry: 3e90 (more details), 2.45 Å

PDB Description: West Nile vi rus NS2B-NS3protease in complexed with inhibitor Naph-KKR-H
PDB Compounds: (A:) NS2B cofactor

SCOPe Domain Sequences for d3e90a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e90a_ g.96.1.1 (A:) automated matches {West Nile virus [TaxId: 11082]}
dmwiertadiswesdaeitgsservdvrldddgnfqlmndpgagggg

SCOPe Domain Coordinates for d3e90a_:

Click to download the PDB-style file with coordinates for d3e90a_.
(The format of our PDB-style files is described here.)

Timeline for d3e90a_: