Class g: Small proteins [56992] (98 folds) |
Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily) |
Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex |
Family g.96.1.1: Flavivirus non-structural protein NS2B-like [310635] (2 proteins) |
Protein automated matches [310851] (1 species) not a true protein |
Species West Nile virus [TaxId:11082] [311209] (3 PDB entries) |
Domain d3e90a_: 3e90 A: [291776] Other proteins in same PDB: d3e90b_, d3e90d_ automated match to d2fp7a_ protein/RNA complex; complexed with nkk |
PDB Entry: 3e90 (more details), 2.45 Å
SCOPe Domain Sequences for d3e90a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e90a_ g.96.1.1 (A:) automated matches {West Nile virus [TaxId: 11082]} dmwiertadiswesdaeitgsservdvrldddgnfqlmndpgagggg
Timeline for d3e90a_: