SCOPe 2.07: Domain d1qfeb_: 1qfe B:

Lineage for d1qfeb_ (1qfe B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Type I 3-dehydroquinate dehydratase [51586] (4 species)

7. Species Salmonella typhi [TaxId:90370] [51587] (3 PDB entries)

8. Domain d1qfeb_: 1qfe B: [29168]
   complexed with dhs

Details for d1qfeb_

PDB Entry: 1qfe, 2.1 Å

PDB Description: the structure of type i 3-dehydroquinate dehydratase from salmonella typhi

PDB Compounds: (B:) protein (3-dehydroquinate dehydratase)

SCOPe Domain Sequences for d1qfeb_:

Sequence; same for both SEQRES and ATOM records:

>d1qfeb_ c.1.10.1 (B:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]}
mktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqs
vltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftg
dadvkatvdyahahnvyvvmsnhdfhqtpsaeemvsrlrkmqalgadipkiavmpqskhd
vltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkqasapgqiavn
dlrsvlmilhna

Timeline for d1qfeb_:

• d1qfeb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qfeb_ appears in SCOPe 2.06
  
• d1qfeb_ appears in the current release, SCOPe 2.08