SCOPe 2.02: Domain d1qo5h_: 1qo5 H:

Lineage for d1qo5h_ (1qo5 H:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species)

7. Species Human (Homo sapiens), liver isozyme [TaxId:9606] [51578] (3 PDB entries)

8. Domain d1qo5h_: 1qo5 H: [29109]
   complexed with so4

Details for d1qo5h_

PDB Entry: 1qo5, 2.5 Å

PDB Description: fructose 1,6-bisphosphate aldolase from human liver tissue

PDB Compounds: (H:) Fructose-bisphosphate aldolase B

SCOPe Domain Sequences for d1qo5h_:

Sequence; same for both SEQRES and ATOM records:

>d1qo5h_ c.1.10.1 (H:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), liver isozyme [TaxId: 9606]}
ahrfpaltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfre
ilfsvdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagtnk
ettiqgldglsercaqykkdgvdfgkwravlriadqcpsslaiqenanalaryasicqqn
glvpivepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtaghact
kkytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwklsfs
ygralqasalaawggkaankeatqeafmkramancqaakgqyvhtgssgaastqslf

Timeline for d1qo5h_:

• d1qo5h_ first appeared (with stable ids) in SCOP 1.55
  
• d1qo5h_ appears in SCOPe 2.01
  
• d1qo5h_ appears in SCOPe 2.03
  
• d1qo5h_ appears in the current release, SCOPe 2.08