Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species) |
Species Human (Homo sapiens), liver isozyme [TaxId:9606] [51578] (3 PDB entries) |
Domain d1qo5h_: 1qo5 H: [29109] complexed with so4 |
PDB Entry: 1qo5 (more details), 2.5 Å
SCOPe Domain Sequences for d1qo5h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qo5h_ c.1.10.1 (H:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), liver isozyme [TaxId: 9606]} ahrfpaltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfre ilfsvdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagtnk ettiqgldglsercaqykkdgvdfgkwravlriadqcpsslaiqenanalaryasicqqn glvpivepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtaghact kkytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwklsfs ygralqasalaawggkaankeatqeafmkramancqaakgqyvhtgssgaastqslf
Timeline for d1qo5h_: