Lineage for d1dhpb_ (1dhp B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 385592Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 385593Family c.1.10.1: Class I aldolase [51570] (10 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 385652Protein Dihydrodipicolinate synthase [51574] (2 species)
  7. 385653Species Escherichia coli [TaxId:562] [51575] (4 PDB entries)
  8. 385661Domain d1dhpb_: 1dhp B: [29098]
    complexed with k; mutant

Details for d1dhpb_

PDB Entry: 1dhp (more details), 2.5 Å

PDB Description: dihydrodipicolinate synthase

SCOP Domain Sequences for d1dhpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dhpb_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Escherichia coli}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

SCOP Domain Coordinates for d1dhpb_:

Click to download the PDB-style file with coordinates for d1dhpb_.
(The format of our PDB-style files is described here.)

Timeline for d1dhpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dhpa_