Lineage for d1dhpb_ (1dhp B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.10: Aldolase [51569] (4 families) 
Family c.1.10.1: Class I aldolase [51570] (6 proteins) 
Protein Dihydrodipicolinate synthase [51574] (1 species) Species Escherichia coli [TaxId:562] [51575] (1 PDB entry) 
Domain d1dhpb_: 1dhp B: [29098]
Details for d1dhpb_
PDB Entry: 1dhp (more details), 2.5 Å
PDB Description: dihydrodipicolinate synthase
SCOP Domain Sequences for d1dhpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dhpb_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Escherichia coli}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll
SCOP Domain Coordinates for d1dhpb_:
Click to download the PDB-style file with coordinates for d1dhpb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dhpb_:
- d1dhpb_ appears in SCOP 1.57
- d1dhpb_ appears in the current release, SCOPe 2.08
View in 3D
