Lineage for d3auga_ (3aug A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259689Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 2259690Protein automated matches [190829] (11 species)
    not a true protein
  7. 2259696Species Cow (Bos taurus) [TaxId:9913] [255754] (7 PDB entries)
  8. 2259701Domain d3auga_: 3aug A: [290865]
    automated match to d4wxvc_
    complexed with so4

Details for d3auga_

PDB Entry: 3aug (more details), 1.4 Å

PDB Description: A simplified BPTI variant with poly Pro amino acid tag (C5P) at the C-terminus
PDB Compounds: (A:) bovine pancreatic trypsin inhibitor

SCOPe Domain Sequences for d3auga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3auga_ g.8.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaag

SCOPe Domain Coordinates for d3auga_:

Click to download the PDB-style file with coordinates for d3auga_.
(The format of our PDB-style files is described here.)

Timeline for d3auga_: