Lineage for d1fdyc_ (1fdy C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572455Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 572456Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 572682Protein N-acetylneuraminate lyase [51571] (2 species)
  7. 572683Species Escherichia coli [TaxId:562] [51572] (4 PDB entries)
  8. 572694Domain d1fdyc_: 1fdy C: [29073]

Details for d1fdyc_

PDB Entry: 1fdy (more details), 2.45 Å

PDB Description: n-acetylneuraminate lyase in complex with hydroxypyruvate

SCOP Domain Sequences for d1fdyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdyc_ c.1.10.1 (C:) N-acetylneuraminate lyase {Escherichia coli}
nlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereqvl
eivaeegkgkikliahvgcvttaesqqlaasakrygfdavsavtpfyypfsfeehcdhyr
aiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirrehpd
lvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnkvi
dlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmq

SCOP Domain Coordinates for d1fdyc_:

Click to download the PDB-style file with coordinates for d1fdyc_.
(The format of our PDB-style files is described here.)

Timeline for d1fdyc_: