Lineage for d1a5oc2 (1a5o C:130-422,C:476-567)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 385405Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 385429Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 385430Protein alpha-subunit of urease, catalytic domain [51561] (3 species)
  7. 385441Species Klebsiella aerogenes [TaxId:28451] [51562] (27 PDB entries)
  8. 385466Domain d1a5oc2: 1a5o C:130-422,C:476-567 [29052]
    Other proteins in same PDB: d1a5oa_, d1a5ob_, d1a5oc1
    complexed with fmt, ni; mutant

Details for d1a5oc2

PDB Entry: 1a5o (more details), 2.5 Å

PDB Description: k217c variant of klebsiella aerogenes urease, chemically rescued by formate and nickel

SCOP Domain Sequences for d1a5oc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5oc2 c.1.9.2 (C:130-422,C:476-567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes}
gidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrmlqaadslpv
nigllgkgnvsqpdalreqvaagviglcihedwgatpaaidcaltvademdiqvalhsdt
lnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnptlpytlnti
dehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssdsqamgrvge
vilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgXmfgalg
sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
evrvdgelitsepadvlpmaqryflf

SCOP Domain Coordinates for d1a5oc2:

Click to download the PDB-style file with coordinates for d1a5oc2.
(The format of our PDB-style files is described here.)

Timeline for d1a5oc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5oc1