Lineage for d1fwgc2 (1fwg C:130-422,C:476-567)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 306527Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 306547Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 306548Protein alpha-subunit of urease, catalytic domain [51561] (3 species)
  7. 306558Species Klebsiella aerogenes [TaxId:28451] [51562] (26 PDB entries)
  8. 306568Domain d1fwgc2: 1fwg C:130-422,C:476-567 [29035]
    Other proteins in same PDB: d1fwga_, d1fwgb_, d1fwgc1
    complexed with ni; mutant

Details for d1fwgc2

PDB Entry: 1fwg (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319s variant

SCOP Domain Sequences for d1fwgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwgc2 c.1.9.2 (C:130-422,C:476-567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes}
gidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrmlqaadslpv
nigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdiqvalhsdt
lnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnptlpytlnti
dehldmlmvshhldpdiaedvafaesrirretiaaedvlhdlgafsltssdsqamgrvge
vilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgXmfgalg
sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
evrvdgelitsepadvlpmaqryflf

SCOP Domain Coordinates for d1fwgc2:

Click to download the PDB-style file with coordinates for d1fwgc2.
(The format of our PDB-style files is described here.)

Timeline for d1fwgc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fwgc1