Lineage for d1c90b_ (1c90 B:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.5: Type II chitinase [51534] (9 proteins) 
Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species) 
Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries) 
Domain d1c90b_: 1c90 B: [28997]
Details for d1c90b_
PDB Entry: 1c90 (more details), 2.1 Å
PDB Description: endo-beta-n-acetylglucosaminidase h, e132q mutant
SCOP Domain Sequences for d1c90b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c90b_ c.1.8.5 (B:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H}
kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
gvdfddqyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
ldggdrtadvsaftrelygseavrt
SCOP Domain Coordinates for d1c90b_:
Click to download the PDB-style file with coordinates for d1c90b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c90b_:
- d1c90b_ first appeared (with stable ids) in SCOP 1.55
- d1c90b_ appears in SCOP 1.59
- d1c90b_ appears in SCOP 1.63
- d1c90b_ appears in the current release, SCOPe 2.08
View in 3D
