Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
Protein Plant beta-glucosidase (myrosinase) [51522] (4 species) |
Species White mustard (Sinapis alba) [TaxId:3728] [51523] (18 PDB entries) |
Domain d1e71m_: 1e71 M: [28921] complexed with asc, gol, nag, so4, zn |
PDB Entry: 1e71 (more details), 1.5 Å
SCOPe Domain Sequences for d1e71m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e71m_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} eitcqenlpftcgntdalnsssfssdfifgvassayqiegtigrglniwdgfthrypnks gpdhgngdttcdsfsywqkdidvldelnatgyrfsiawsriiprgkrsrgvnekgidyyh glisglikkgitpfvtlfhwdlpqtlqdeyegfldpqiiddfkdyadlcfeefgdsvkyw ltinqlysvptrgygsaldapgrcsptvdpscyagnsstepyivahhqllahakvvdlyr knythqggkigptmitrwflpyndtdrhsiaatermkefflgwfmgpltngtypqimidt vgerlpsfspeesnlvkgsydflglnyyftqyaqpspnpvnstnhtammdagakltyina sghyigplfekdkadstdniyyypkgiysvmdyfknkyynpliyvtengistpgdenrnq smldytridylcshlcflnkvikekdvnvkgylawalgdnyefnkgftvrfglsyidwnn vtdrdlkksgqwyqsfisp
Timeline for d1e71m_: