Lineage for d1fhda_ (1fhd A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 305956Family c.1.8.3: beta-glycanases [51487] (16 proteins)
    consist of a number of sequence families
  6. 306194Protein Xylanase A, catalytic core [51514] (6 species)
  7. 306195Species Cellulomonas fimi [TaxId:1708] [51520] (9 PDB entries)
    synonym: beta-1,4-glycanase Cex
  8. 306199Domain d1fhda_: 1fhd A: [28915]
    complexed with xim, xys

Details for d1fhda_

PDB Entry: 1fhd (more details), 1.9 Å

PDB Description: crystal structure of the xylanase cex with xylobiose-derived imidazole inhibitor

SCOP Domain Sequences for d1fhda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhda_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf

SCOP Domain Coordinates for d1fhda_:

Click to download the PDB-style file with coordinates for d1fhda_.
(The format of our PDB-style files is described here.)

Timeline for d1fhda_: