Lineage for d1xyfa2 (1xyf A:1-303)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 305956Family c.1.8.3: beta-glycanases [51487] (16 proteins)
    consist of a number of sequence families
  6. 306194Protein Xylanase A, catalytic core [51514] (6 species)
  7. 306228Species Streptomyces olivaceoviridis [TaxId:1921] [51519] (7 PDB entries)
    N-terminal domain; fused with a ricin A-like beta-trefoil domain
  8. 306229Domain d1xyfa2: 1xyf A:1-303 [28909]
    Other proteins in same PDB: d1xyfa1, d1xyfb1

Details for d1xyfa2

PDB Entry: 1xyf (more details), 1.9 Å

PDB Description: endo-1,4-beta-xylanase from streptomyces olivaceoviridis

SCOP Domain Sequences for d1xyfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyfa2 c.1.8.3 (A:1-303) Xylanase A, catalytic core {Streptomyces olivaceoviridis}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOP Domain Coordinates for d1xyfa2:

Click to download the PDB-style file with coordinates for d1xyfa2.
(The format of our PDB-style files is described here.)

Timeline for d1xyfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xyfa1