Lineage for d1tuxa_ (1tux A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094224Protein Xylanase A, catalytic core [51514] (8 species)
  7. 2094304Species Thermoascus aurantiacus [TaxId:5087] [51518] (11 PDB entries)
  8. 2094312Domain d1tuxa_: 1tux A: [28907]
    X-ray determined sequence differs from that in other entries

Details for d1tuxa_

PDB Entry: 1tux (more details), 1.8 Å

PDB Description: high resolution crystal structure of a thermostable xylanase from thermoascus aurantiacus
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1tuxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuxa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]}
aaaqsvdqlidargkvyfgvatdqnrlttgknaaiiqadfgqvtpensmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvwhsqlpswvvsitdkntltnvmknhittimtryi
gkirawdvvneafnedgslrqtvfnnvigedyipiafrtaraadpnaklyindynldsas
kpktsaivkrvkkwraagvpidgigsqthlsagqgasidaalpnlasagtpevaiteldi
agatstdyvdvvnacldvdscigitvwgvadpdswrasttpllfdgnfnpkpaynaivql
l

SCOPe Domain Coordinates for d1tuxa_:

Click to download the PDB-style file with coordinates for d1tuxa_.
(The format of our PDB-style files is described here.)

Timeline for d1tuxa_: