SCOP 1.65: Domain d1tux__: 1tux -

Lineage for d1tux__ (1tux -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.3: beta-glycanases [51487] (16 proteins)
   consist of a number of sequence families

6. Protein Xylanase A, catalytic core [51514] (6 species)

7. Species Thermoascus aurantiacus [TaxId:5087] [51518] (9 PDB entries)

8. Domain d1tux__: 1tux - [28907]
   X-ray determined sequence differs from that in other entries

Details for d1tux__

PDB Entry: 1tux, 1.8 Å

PDB Description: high resolution crystal structure of a thermostable xylanase from thermoascus aurantiacus

SCOP Domain Sequences for d1tux__:

Sequence; same for both SEQRES and ATOM records:

>d1tux__ c.1.8.3 (-) Xylanase A, catalytic core {Thermoascus aurantiacus}
aaaqsvdqlidargkvyfgvatdqnrlttgknaaiiqadfgqvtpensmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvwhsqlpswvvsitdkntltnvmknhittimtryi
gkirawdvvneafnedgslrqtvfnnvigedyipiafrtaraadpnaklyindynldsas
kpktsaivkrvkkwraagvpidgigsqthlsagqgasidaalpnlasagtpevaiteldi
agatstdyvdvvnacldvdscigitvwgvadpdswrasttpllfdgnfnpkpaynaivql
l

Timeline for d1tux__:

• d1tux__ first appeared (with stable ids) in SCOP 1.55
  
• d1tux__ appears in SCOP 1.63
  
• d1tux__ appears in SCOP 1.67
  
• d1tux__ appears in the current release, SCOPe 2.08, called d1tuxa_