Lineage for d1clxd_ (1clx D:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 305956Family c.1.8.3: beta-glycanases [51487] (16 proteins)
    consist of a number of sequence families
  6. 306194Protein Xylanase A, catalytic core [51514] (6 species)
  7. 306213Species Pseudomonas fluorescens [TaxId:294] [51517] (3 PDB entries)
  8. 306217Domain d1clxd_: 1clx D: [28902]
    complexed with ca

Details for d1clxd_

PDB Entry: 1clx (more details), 1.8 Å

PDB Description: catalytic core of xylanase a

SCOP Domain Sequences for d1clxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clxd_ c.1.8.3 (D:) Xylanase A, catalytic core {Pseudomonas fluorescens}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals

SCOP Domain Coordinates for d1clxd_:

Click to download the PDB-style file with coordinates for d1clxd_.
(The format of our PDB-style files is described here.)

Timeline for d1clxd_: