Lineage for d1clxd_ (1clx D:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.3: beta-glycanases [51487] (13 proteins) 
Protein Xylanase A, catalytic core [51514] (6 species) 
Species Pseudomonas fluorescens [TaxId:294] [51517] (3 PDB entries) 
Domain d1clxd_: 1clx D: [28902]
Details for d1clxd_
PDB Entry: 1clx (more details), 1.8 Å
PDB Description: catalytic core of xylanase a
SCOP Domain Sequences for d1clxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clxd_ c.1.8.3 (D:) Xylanase A, catalytic core {Pseudomonas fluorescens}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals
SCOP Domain Coordinates for d1clxd_:
Click to download the PDB-style file with coordinates for d1clxd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1clxd_:
- d1clxd_ first appeared (with stable ids) in SCOP 1.55
- d1clxd_ appears in SCOP 1.57
- d1clxd_ appears in SCOP 1.61
- d1clxd_ appears in the current release, SCOPe 2.08
View in 3D
