Lineage for d1ghsb_ (1ghs B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682589Family c.1.8.3: beta-glycanases [51487] (24 proteins)
    consist of a number of sequence families
  6. 682947Protein Plant beta-glucanases [51507] (3 species)
  7. 682954Species Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId:4513] [51508] (1 PDB entry)
  8. 682956Domain d1ghsb_: 1ghs B: [28841]

Details for d1ghsb_

PDB Entry: 1ghs (more details), 2.3 Å

PDB Description: the three-dimensional structures of two plant beta-glucan endohydrolases with distinct substrate specificities
PDB Compounds: (B:) 1,3-beta-glucanase

SCOP Domain Sequences for d1ghsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghsb_ c.1.8.3 (B:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]}
igvcygvignnlpsrsdvvqlyrskgingmriyfadgqalsalrnsgiglildigndqla
niaastsnaaswvqnnvrpyypavnikyiaagnevqggatqsilpamrnlnaalsaaglg
aikvstsirfdevansfppsagvfknaymtdvarllastgapllanvypyfayrdnpgsi
slnyatfqpgttvrdqnngltytslfdamvdavyaalekagapavkvvvsesgwpsaggf
aasagnartynqglinhvgggtpkkrealetyifamfnenqktgdatersfglfnpdksp
ayniqf

SCOP Domain Coordinates for d1ghsb_:

Click to download the PDB-style file with coordinates for d1ghsb_.
(The format of our PDB-style files is described here.)

Timeline for d1ghsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ghsa_