Lineage for d5a3ha_ (5a3h A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439595Protein Endoglucanase Cel5a [51499] (4 species)
  7. 2439596Species Bacillus agaradhaerens [TaxId:76935] [51500] (21 PDB entries)
    Uniprot O85465 30-329
  8. 2439613Domain d5a3ha_: 5a3h A: [28823]
    complexed with ffc

Details for d5a3ha_

PDB Entry: 5a3h (more details), 1.82 Å

PDB Description: 2-deoxy-2-fluro-b-d-cellobiosyl/enzyme intermediate complex of the endoglucanase cel5a from bacillus agaradhearans at 1.8 angstroms resolution
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d5a3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires

SCOPe Domain Coordinates for d5a3ha_:

Click to download the PDB-style file with coordinates for d5a3ha_.
(The format of our PDB-style files is described here.)

Timeline for d5a3ha_: