Lineage for d1c0db_ (1c0d B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474407Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 474594Protein Endocellulase E1 [51497] (1 species)
  7. 474595Species Acidothermus cellulolyticus [TaxId:28049] [51498] (2 PDB entries)
  8. 474599Domain d1c0db_: 1c0d B: [28816]

Details for d1c0db_

PDB Entry: 1c0d (more details), 2.4 Å

PDB Description: endocellulase e1 from acidothermus cellulolyticus mutant y245g

SCOP Domain Sequences for d1c0db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0db_ c.1.8.3 (B:) Endocellulase E1 {Acidothermus cellulolyticus}
agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv

SCOP Domain Coordinates for d1c0db_:

Click to download the PDB-style file with coordinates for d1c0db_.
(The format of our PDB-style files is described here.)

Timeline for d1c0db_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c0da_