Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.3: beta-glycanases [51487] (24 proteins) consist of a number of sequence families |
Protein Exo-beta-(1,3)-glucanase [51495] (2 species) |
Species Yeast (Candida albicans) [TaxId:5476] [51496] (4 PDB entries) |
Domain d1eqpa_: 1eqp A: [28812] |
PDB Entry: 1eqp (more details), 1.9 Å
SCOP Domain Sequences for d1eqpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqpa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaasri lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagewsaaltdcakwlng vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk tenapewsfqtltynglfpqpvtdrqfpnqcgfh
Timeline for d1eqpa_: