Lineage for d1edga_ (1edg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830948Protein Endoglucanase CelA [51491] (1 species)
  7. 2830949Species Clostridium cellulolyticum [TaxId:1521] [51492] (1 PDB entry)
  8. 2830950Domain d1edga_: 1edg A: [28807]

Details for d1edga_

PDB Entry: 1edg (more details), 1.6 Å

PDB Description: single crystal structure determination of the catalytic domain of celcca carried out at 15 degree c
PDB Compounds: (A:) endoglucanase A

SCOPe Domain Sequences for d1edga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]}
mydaslipnlqipqknipnndgmnfvkglrlgwnlgntfdafngtnitneldyetswsgi
kttkqmidaikqkgfntvripvswhphvsgsdykisdvwmnrvqevvnycidnkmyviln
thhdvdkvkgyfpssqymasskkyitsvwaqiaarfanydehlifegmneprlvghanew
wpeltnsdvvdsincinqlnqdfvntvratggknasrylmcpgyvaspdgatndyfrmpn
disgnnnkiivsvhaycpwnfaglamadggtnawnindskdqsevtwfmdniynkytsrg
ipviigecgavdknnlktrveymsyyvaqakargilcilwdnnnfsgtgelfgffdrrsc
qfkfpeiidgmvkyafglin

SCOPe Domain Coordinates for d1edga_:

Click to download the PDB-style file with coordinates for d1edga_.
(The format of our PDB-style files is described here.)

Timeline for d1edga_: