PDB entry 1edg

View 1edg on RCSB PDB site
Description: single crystal structure determination of the catalytic domain of celcca carried out at 15 degree c
Class: cellulose degradation
Keywords: family a, cellulases, xylanases, family 5 of glycosyl hydrolase, cellulose degradation
Deposited on 1995-07-07, released 1996-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase A
    Species: Clostridium cellulolyticum [TaxId:394503]
    Gene: CELCCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1edga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1edgA (A:)
    mydaslipnlqipqknipnndgmnfvkglrlgwnlgntfdafngtnitneldyetswsgi
    kttkqmidaikqkgfntvripvswhphvsgsdykisdvwmnrvqevvnycidnkmyviln
    thhdvdkvkgyfpssqymasskkyitsvwaqiaarfanydehlifegmneprlvghanew
    wpeltnsdvvdsincinqlnqdfvntvratggknasrylmcpgyvaspdgatndyfrmpn
    disgnnnkiivsvhaycpwnfaglamadggtnawnindskdqsevtwfmdniynkytsrg
    ipviigecgavdknnlktrveymsyyvaqakargilcilwdnnnfsgtgelfgffdrrsc
    qfkfpeiidgmvkyafglin