Lineage for d1btc__ (1btc -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384383Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 384529Protein beta-Amylase [51481] (3 species)
    Common fold covers whole protein structure
  7. 384532Species Soybean (Glycine max) [TaxId:3847] [51482] (13 PDB entries)
  8. 384539Domain d1btc__: 1btc - [28791]
    complexed with glc, seo, so4

Details for d1btc__

PDB Entry: 1btc (more details), 2 Å

PDB Description: three-dimensional structure of soybean beta-amylase determined at 3.0 angstroms resolution: preliminary chain tracing of the complex with alpha-cyclodextrin

SCOP Domain Sequences for d1btc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btc__ c.1.8.1 (-) beta-Amylase {Soybean (Glycine max)}
snmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgp
kqydwrayrslfqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifyt
nrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpa
gelrypsypqsqgwefprigefqcydkylkadfkaavaraghpewelpddagkyndvpes
tgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwyk
venhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvq
qvlsggwredirvagenalprydataynqiilnakpqgvnnngppklsmfgvtylrlsdd
llqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfp
wlpetdmkvdg

SCOP Domain Coordinates for d1btc__:

Click to download the PDB-style file with coordinates for d1btc__.
(The format of our PDB-style files is described here.)

Timeline for d1btc__: