SCOP 1.63: Domain d1d7fa4: 1d7f A:1-406

Lineage for d1d7fa4 (1d7f A:1-406)

Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

Family c.1.8.1: Amylase, catalytic domain [51446] (21 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

Protein Cyclodextrin glycosyltransferase [51452] (5 species)
contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
Species Alkalophilic bacillus sp., strain 1011 [51456] (4 PDB entries)
Domain d1d7fa4: 1d7f A:1-406 [28742]
Other proteins in same PDB: d1d7fa1, d1d7fa2, d1d7fa3, d1d7fb1, d1d7fb2, d1d7fb3

Details for d1d7fa4

PDB Entry: 1d7f (more details), 1.9 Å

PDB Description: crystal structure of asparagine 233-replaced cyclodextrin glucanotransferase from alkalophilic bacillus sp. 1011 determined at 1.9 a resolution

SCOP Domain Sequences for d1d7fa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7fa4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Alkalophilic bacillus sp., strain 1011}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavknmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

SCOP Domain Coordinates for d1d7fa4:

Click to download the PDB-style file with coordinates for d1d7fa4.
(The format of our PDB-style files is described here.)

Timeline for d1d7fa4: