Lineage for d1cwn__ (1cwn -)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) 
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (8 proteins) 
Protein Aldose reductase (aldehyde reductase) [51436] (2 species) 
Species Pig (Sus scrofa) [TaxId:9823] [51438] (8 PDB entries) 
Domain d1cwn__: 1cwn - [28686]
Details for d1cwn__
PDB Entry: 1cwn (more details), 2 Å
PDB Description: crystal structure of porcine aldehyde reductase holoenzyme
SCOP Domain Sequences for d1cwn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cwn__ c.1.7.1 (-) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa)}
aascvllhtgqkmpliglgtwksepgqvkaaikyaltvgyrhidcaaiygneleigealt
etvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyaferg
dnpfpknadgtirydathykdtwkalealvakglvralglsnfssrqiddvlsvasvrpa
vlqvechpylaqneliahcqarglevtaysplgssdrawrdpnepvlleepvvqalaeky
nrspaqillrwqvqrkvicipksvtpsripqniqvfdftfspeemkqldalnknlrfivp
mltvdgkrvprdaghplypfndpy
SCOP Domain Coordinates for d1cwn__:
Click to download the PDB-style file with coordinates for d1cwn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cwn__:
- d1cwn__ first appeared (with stable ids) in SCOP 1.55
- d1cwn__ appears in SCOP 1.59
- d1cwn__ appears in SCOP 1.63
- d1cwn__ appears in the current release, SCOPe 2.08, called d1cwna_
View in 3D