SCOP 1.67: Domain d1f3tc2: 1f3t C:44-283

Lineage for d1f3tc2 (1f3t C:44-283)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)

6. Protein Eukaryotic ornithine decarboxylase [51423] (3 species)

7. Species Trypanosoma brucei [TaxId:5691] [51426] (4 PDB entries)

8. Domain d1f3tc2: 1f3t C:44-283 [28657]
   Other proteins in same PDB: d1f3ta1, d1f3tb1, d1f3tc1, d1f3td1

Details for d1f3tc2

PDB Entry: 1f3t, 2 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase (odc) complexed with putrescine, odc's reaction product.

SCOP Domain Sequences for d1f3tc2:

Sequence, based on SEQRES records:

>d1f3tc2 c.1.6.1 (C:44-283) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar
crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt
elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Sequence, based on observed residues (ATOM records):

>d1f3tc2 c.1.6.1 (C:44-283) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddrlsv
kfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfn
mhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Timeline for d1f3tc2:

• d1f3tc2 first appeared (with stable ids) in SCOP 1.55
  
• d1f3tc2 appears in SCOP 1.65
  
• d1f3tc2 appears in SCOP 1.69
  
• d1f3tc2 appears in the current release, SCOPe 2.08