Lineage for d1djqa1 (1djq A:1-340)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1338072Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1338073Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1338346Protein Trimethylamine dehydrogenase, N-terminal domain [51406] (1 species)
    two other domains are alpha/beta Rossmann-like fold and beta/beta/alpha fold
  7. 1338347Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51407] (5 PDB entries)
  8. 1338350Domain d1djqa1: 1djq A:1-340 [28614]
    Other proteins in same PDB: d1djqa2, d1djqa3, d1djqb2, d1djqb3
    complexed with adp, fmn, sf4; mutant

Details for d1djqa1

PDB Entry: 1djq (more details), 2.2 Å

PDB Description: structural and biochemical characterization of recombinant c30a mutant of trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)
PDB Compounds: (A:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d1djqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ardpkhdilfepiqigpktlrnrfyqvphaigagsdkpgfqsahrsvkaeggwaalntey
csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
tdpekmieivtkgyadiigcarpsiadpflpqkveqgryd

SCOPe Domain Coordinates for d1djqa1:

Click to download the PDB-style file with coordinates for d1djqa1.
(The format of our PDB-style files is described here.)

Timeline for d1djqa1: