| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
| Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains) |
| Protein Trimethylamine dehydrogenase, N-terminal domain [51406] (1 species) two other domains are alpha/beta Rossmann-like fold and beta/beta/alpha fold |
| Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51407] (5 PDB entries) |
| Domain d1djqa1: 1djq A:1-340 [28614] Other proteins in same PDB: d1djqa2, d1djqa3, d1djqb2, d1djqb3 complexed with adp, fmn, sf4; mutant |
| PDB Entry: 1djq (more details) PDB Description: structural and biochemical characterization of recombinant c of trimethylamine dehydrogenase from methylophilus methylot (sp. w3a1)
PDB Compounds: (A:) trimethylamine dehydrogenaseSCOP Domain Sequences for d1djqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ardpkhdilfepiqigpktlrnrfyqvphaigagsdkpgfqsahrsvkaeggwaalntey
csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
tdpekmieivtkgyadiigcarpsiadpflpqkveqgryd
SCOP Domain Coordinates for d1djqa1:
Click to download the PDB-style file with coordinates for d1djqa1. (The format of our PDB-style files is described here.)
Timeline for d1djqa1:
d1djqa1 appears in SCOP 1.75A | d1djqa1 (click for larger image) d1djqa1 in context of chain Domains from same chain: d1djqa2, d1djqa3 d1djqa1 in context of PDB Domains from other chains: d1djqb1, d1djqb2, d1djqb3 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |