Lineage for d1bwka_ (1bwk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828208Protein Old yellow enzyme (OYE) [51401] (2 species)
  7. 2828230Species Yeast (Candida albicans) [TaxId:5476] [51403] (2 PDB entries)
  8. 2828231Domain d1bwka_: 1bwk A: [28605]
    complexed with fmn; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1bwka_

PDB Entry: 1bwk (more details), 2.3 Å

PDB Description: old yellow enzyme (oye1) mutant h191n
PDB Compounds: (A:) protein (nadph dehydrogenase 1)

SCOPe Domain Sequences for d1bwka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwka_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Yeast (Candida albicans) [TaxId: 5476]}
sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlwvlgw
aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
iaagadgveinsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
ekglplnkydrdtfyqmsahgyidyptyeealklgwdks

SCOPe Domain Coordinates for d1bwka_:

Click to download the PDB-style file with coordinates for d1bwka_.
(The format of our PDB-style files is described here.)

Timeline for d1bwka_: