Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
Protein Trp synthase alpha-subunit [51388] (9 species) |
Species Salmonella typhimurium [TaxId:90371] [51389] (72 PDB entries) |
Domain d1c9da_: 1c9d A: [28586] Other proteins in same PDB: d1c9db_ complexed with hf1, na, plp |
PDB Entry: 1c9d (more details), 2.3 Å
SCOPe Domain Sequences for d1c9da_:
Sequence, based on SEQRES records: (download)
>d1c9da_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg vtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkii eknlaspkqmlaelrsfvsamkaasr
>d1c9da_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg vtgaenrgplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiiek nlaspkqmlaelrsfvsamkaasr
Timeline for d1c9da_: