PDB entry 1c9d

View 1c9d on RCSB PDB site
Description: crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-hydroxy-4-fluorophenylthio)-butylphosphonic acid
Class: lyase
Keywords: 8-fold alpha-beta barrel, enzyme-inhibitor complex, lyase
Deposited on 1999-08-02, released 1999-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase (alpha chain)
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9da_
  • Chain 'B':
    Compound: tryptophan synthase (beta chain)
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9db_
  • Heterogens: NA, PLP, HF1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c9dA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9dA (A:)
    eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
    ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
    gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
    vtgaenrgplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiiek
    nlaspkqmlaelrsfvsamkaasr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c9dB (B:)
    mttllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptalt
    kcqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasa
    lasallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgs
    yetahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigm
    fadfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysi
    sagldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalk
    mmreqpekeqllvvnlsgrgdkdiftvhdilkargei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9dB (B:)
    tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
    qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
    sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
    tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
    dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
    gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
    reqpekeqllvvnlsgrgdkdiftvhd