Lineage for d1dvjc_ (1dvj C:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116030Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 116054Family c.1.2.3: Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51375] (1 protein)
  6. 116055Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 116056Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (2 PDB entries)
  8. 116059Domain d1dvjc_: 1dvj C: [28548]

Details for d1dvjc_

PDB Entry: 1dvj (more details), 1.5 Å

PDB Description: crystal structure of orotidine monophosphate decarboxylase complexed with 6-azaump

SCOP Domain Sequences for d1dvjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvjc_ c.1.2.3 (C:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
pgetlrfadaiivgrsiyladnpaaaaagiiesikdllipedpaankarkeaelaa

SCOP Domain Coordinates for d1dvjc_:

Click to download the PDB-style file with coordinates for d1dvjc_.
(The format of our PDB-style files is described here.)

Timeline for d1dvjc_: