SCOP 1.59: Domain d1eixb_: 1eix B:

Lineage for d1eixb_ (1eix B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families)

5. Family c.1.2.3: Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51375] (1 protein)

6. Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)

7. Species Escherichia coli [TaxId:562] [51378] (2 PDB entries)

8. Domain d1eixb_: 1eix B: [28543]

Details for d1eixb_

PDB Entry: 1eix, 2.5 Å

PDB Description: structure of orotidine 5'-monophosphate decarboxylase from e. coli, co-crystallised with the inhibitor bmp

SCOP Domain Sequences for d1eixb_:

Sequence; same for both SEQRES and ATOM records:

>d1eixb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli}
vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq

Timeline for d1eixb_:

• d1eixb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eixb_ appears in SCOP 1.57
  
• d1eixb_ appears in SCOP 1.61
  
• d1eixb_ appears in the current release, SCOPe 2.08